PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma33g00410.1
Common NameZOSMA_33G00410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 760aa    MW: 82671.3 Da    PI: 7.5387
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma33g00410.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-095475841954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Zosma33g00410.1 547 FEHflHPYPSDADKHLLARQTGLSRNQVTNWFINARVR 584
                      664459******************************88 PP

2BELL124.54.2e-40409478372
             BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       e+q++k+kLls+l+eVd+rY++y++q+q+v++sF+ v+g+gsa+pYtslA+ka+SrhFrcLkdai  q+
  Zosma33g00410.1 409 FEHQRRKTKLLSMLDEVDRRYNHYCDQMQMVVNSFDSVMGYGSATPYTSLAQKAMSRHFRCLKDAILAQL 478
                      599***************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.0E-62324476IPR006563POX domain
PfamPF075263.2E-51329474IPR006563POX domain
PROSITE profilePS5007112.519525588IPR001356Homeobox domain
CDDcd000869.59E-12528589No hitNo description
SMARTSM003891.3E-9528592IPR001356Homeobox domain
SuperFamilySSF466895.13E-17530595IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28531594IPR009057Homeodomain-like
PfamPF059203.0E-18545584IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MGIAPPQSSS ITTCNTFLVS RNIDDVRRFH HRKRRNGEDN RRIVKEVNST GSMSQGFHHQ  60
GIFGFSDGFD RSTQASNQQE QTAGSRRGGE SPGVRMQQQH TRFGDPPSLV PIETAGEDHS  120
GAVAAAMYDT QGGASMLSDM FGFQHPDGGP SATDLLASQI PSGYRFNRPP PVPTPTGDWY  180
GTTSRQATEM FLMNPSQQQQ QQQRSSSPSA VIHHNFQTTP PSGGQPPSAQ PFVMEGQGLS  240
LSLSSSLQQF EMANKAQQET ELRVREGMLY YNSGGGGGGV SSTHHHHHQN QPLLQHHQMF  300
QQSQPQGIPV GIGQSGVVGG GGPMEVVNVL RHSKYARAAQ ELLEEFCSVG RGGKGVASKL  360
NPSSSNLAGG GASTSKEAAT TTTTTTTTTS NTTTTPPPPP PALSAADKFE HQRRKTKLLS  420
MLDEVDRRYN HYCDQMQMVV NSFDSVMGYG SATPYTSLAQ KAMSRHFRCL KDAILAQLKQ  480
TCELLGDKDG GGGTGITKGE TPRLKLLEQS LRQQRAFHQM GIMEQEAWRP QRGLPERSVN  540
ILRAWLFEHF LHPYPSDADK HLLARQTGLS RNQVTNWFIN ARVRLWKPMV EEMYQQEAKE  600
EEEERGGEGS NSRSQSQKQE ISTDENDPSS SFPRLHHQQQ EHRFTPNETT TTTNQQHGGG  660
IGIGTSSSGN SFPELIGFDA HGRITGNSTN INTVVTAVTT ATAADEATNY GGTAGMVTPA  720
GTTHIRFGTS GDVSLTLGLR HAGNLPENNR FSSMRDFNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16534592563Homeobox protein Meis2
3k2a_B2e-16534592563Homeobox protein Meis2
4xrs_A1e-16534591158Homeobox protein Meis1
4xrs_B1e-16534591158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079109.11e-177PREDICTED: BEL1-like homeodomain protein 2 isoform X1
RefseqXP_012079108.11e-177PREDICTED: BEL1-like homeodomain protein 2 isoform X1
SwissprotQ9SW801e-144BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0K9P7J50.0A0A0K9P7J5_Z
STRINGPOPTR_0007s12170.11e-170(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-113BEL1-like homeodomain 2